Sommaire pour June 17, 2024 de National Enquirer (2024)

Page d'accueil/Actualité et politiques/National Enquirer/June 17, 2024/DANS CE NUMÉRO

National Enquirer|June 17, 2024CONCEITED COSTNER CLOBBERED!BATTERED Kevin Costner is picking himself up from the sawdust following dismal opening reviews for his new cowboy movie series Horizon — but he’s vowing it’s not over and blaming certain sections of Hollywood for ganging up on him out of petty spite!Critics mauled the former Yellowstone hunk, 69, when he debuted the first of four episodes at the Cannes Film Festival last month.Naysayers sniped the project — which Costner believed would be hailed as a modern masterpiece — was “dull and incoherent” and ridiculed the Hollywood heavyweight for green-lighting it.Worse, the actor reportedly sunk $100 million of his own moolah into the series just as he was coughing up mega millions in his messy divorce with ex-wife Christine Baumgartner, 50.“Kevin is still holding out hope that the final arbiter…1 min

National Enquirer|June 17, 2024DIDDY OR DIDN’T HE?THE walls are closing in on embattled Bad Boys Records music mogul Sean “Diddy” Combs as federal prosecutors round up the rapper’s many sex-assault accusers to spill their guts in front of a grand jury!A new report indicates witnesses have been notified by investigators to prepare to give testimony in New York City, an indication that the Justice Dept. is quick-stepping toward seeking an indictment against the scandal-swamped singer.The 54-year-old is facing eight civil lawsuits — seven of them detailing alleged sex abuse horrors!Although Combs immediately settled with ex-galpal Cassie Ventura, 37 — the first to accuse him of rape and domestic violence — he swore up and down he was innocent, until hotel security-camera footage recently surfaced that seemed to show Diddy hunting down his fleeing girlfriend and stomping…1 min

National Enquirer|June 17, 2024CHEATING SCANDAL STILL MARKS TWAIN!SOFTHEARTED Shania Twain may have forgiven her ex-husband for cheating on her with her best friend, but she definitely hasn’t forgotten. Twain, 58, was married to producer Robert “Mutt” Lange, 75, for 14 years when he embarked on an affair with her BFF, Marie-Anne Thiébaud, in 2008.“Forgiveness is in the family of letting go,” the singer says. “Forgiveness, more specifically for me anyway, is not about forgetting necessarily. It’s about understanding the other person.”In fact, despite the double betrayal, the country hitmaker feels compassion for Lange. “Do I hate my ex-husband for making a mistake? No. It’s his mistake. Not my mistake.[It’s] so sad for him that he made such a great mistake that he has to live with.… That’s not my weight. He’s a human being that deserves empathy…1 min

National Enquirer|June 17, 2024KRAMER VS KRAMER!SCANDAL-SCARRED comic Michael Richards’ life-threatening brush with cancer has inspired him to atone for his mistakes in the final act of his life — and sources say he’s leaning on his old Seinfeld buddies to make it happen!The 74-year-old revealed in his recent memoir, Entrances and Exits, he thought he would lose his battle with the disease, even going so far as to say: “I’m ready to go.”But sources say Michael’s surprise recovery made him realize he still had a second chance to right the wrongs in his life — so he reached out to former castmates Jerry Seinfeld, Julia Louis-Dreyfus and Jason Alexander for help getting back in the game.Richards, who played fan fave Cosmo Kramer on the NBC sitcom, has infamously been out of the limelight since a…1 min

National Enquirer|June 17, 2024SNOOP’S WIFE GETS JIGGY WITH JIGGLE JOINT!BOSS lady Shante Broadus, Snoop Dogg’s longtime wife and manager, is hoping to make it rain by adding one more hustle to her portfolio: a rooftop strip club in downtown Los Angeles!The swanky jiggle joint is expected to be the bump-and-grind play-ground for Tinseltown’s biggest ballers.Finding inspired ways to make bank is a fo’shizzle thing for Broadus, 52, who oversees an empire through her company Boss Lady Entertainment, say sources. It produces movies and TV shows and manages the Compound, an event space that features recording and dance studios.“She’s smart and ambitious and not afraid to be a little ruthless when the situation demands it,” says one insider. “I’m not surprised she’s leveraging Snoop’s connections and cachet to cash in on the L.A. nightclub scene.”She’s been married to the Drop…1 min

National Enquirer|June 17, 2024CRUMBLING LOPEZ CAN’T GET ENOUGH!JITTERY Jennifer Lopez is cracking under the pressure as her career crashes all around her!Sources say the failure of her new album — along with mockery of the Prime Video documentary about her “simple beginnings” in the Bronx — have left the doubtful diva feeling irrelevant to today’s audiences and terrified her time as a top star is terminated!In recent weeks, the former Fly Girl has been put through the meat grinder on social media for treating a reporter like dirt as she imperiously strutted her stuff on the red carpet at the glitzy, star-studded Met Gala in New York City.When the reporter asked her which designer she was wearing, the 54-year-old Boy Next Door star gave a steely glare and a sarcastic response — leading fans to wonder what…2 min

National Enquirer|June 17, 2024NOT SO PRETTY IN PINK!FORMER ’80s teen sensation Molly Ringwald — who starred in the John Hughes hits Sixteen Candles and The Breakfast Club — recalls being “taken advantage of” during her early years as a budding actress!Ringwald, 56, says she wasn’t sexually assaulted, but claims creeps still exploited her!“You can’t be a young actress in Hollywood and not have predators around,” she charges.The Pretty in Pink redhead remembers finding herself “in questionable situations,” but adds, “I do have an incredible survival instinct — and a pretty big superego — and kind of managed to figure out a way to protect myself.”The former Facts of Life kid reveals she had a “shy, introverted” nature during her youth and confides, “I never really felt like I was part of a community when I was in…1 min

National Enquirer|June 17, 2024CODE BREAKERSHOW TO PLAY: Each letter of the alphabet is represented by a number. Use the given letters to get started by filling them in throughout the puzzle. This should give you enough letters to guess more words. Look out for patterns like double letters or the letter “E” as it’s a rather frequently used letter. Codebreaker puzzles use all 26 letters of the alphabet. We don’t use words that are trademarks, abbreviations, hyphenated words, proper nouns or foreign words unless specified by a puzzle theme.ENVIRONMENTALISM Mystery words clue: THE NATURAL WAY OF RECYCLING WASTEREFERENCE GRIDMYSTERY WORDSANSWERS FOR THIS PUZZLE CAN BE FOUND IN NEXT WEEK’S ISSUE…1 min

National Enquirer|June 17, 2024TRAGIC CURSE STALKING AMERICAN IDOL!NUMBERS don’t lie, and the math spells it out in black and white: American Idol is a death trap — and showbiz industry insiders fear the show is cursed!As police investigate April’s mysterious demise of award-winning Christian singer and Idol finalist Mandisa, 47, one thing remains clear — climbing the rungs on this talent competition can bring you closer to meeting your maker.A recent study showed American Idol finalists are SIX times more likely to die than the overall average of Americans aged 15 to 54!The show has had an unfortunate string of odd deaths — including Paula Goodspeed, who committed suicide two years after her 2006 run on season 5.And there has been a staggering number of Idol-adjacent tragedies — including season 5 finalist Kellie Pickler, who suffered the…8 min

National Enquirer|June 17, 2024BLOOD TEST FINDS FUTURE CANCER!GROUNDBREAKING research has revealed a simple blood test can detect cancer seven years earlier than currently possible! Scientists at the U.K.’s University of Oxford say their discovery could help identify people who are at high risk of developing cancer so better strategies for prevention and treatment are developed.“To save more lives from cancer, we need to better understand what happens at the earliest stages of the disease,” says Oxford epidemiologist Dr. Keren Papier.Her team examined blood samples from 44,000-plus subjects, including more than 4,900 people who were later diagnosed with cancer.Using a technique called proteomics that allows scientists to analyze a large set of proteins at once, the researchers compared the blood of folks who developed cancer with those who didn’t. They identified 618 blood proteins linked to 19 types…2 min

National Enquirer|June 17, 2024CHINA SPYING AT BOTTOM OF THE SEA!SINISTER Chinese agents are stealing vital military secrets and valuable intellectual property by tapping into undersea fiber-optic cables carrying much of the world’s internet traffic, fear concerned U.S. officials.In a frightening warning to some of the largest American companies dependent on the undersea lines, intelligence officials say the Chinese are using cable repair ships to install remote devices that allow them to eavesdrop on data flow.The clandestine bugging operations enable Beijing to steal the intellectual property of businesses — and encrypted military communications that use the commercially owned fiber-optic cables, say sources.Giant U.S. corporations like Google and Meta Platforms — the owner of Facebook and Instagram — often use companies that are at least partly owned by Chinese operatives to repair the hundreds of thousands of miles of cable that…2 min

National Enquirer|June 17, 2024YOUR HOROSCOPEARIES MARCH 21-APRIL 20The concerns that you have grown accustomed to sweeping aside will now need addressing. It’s time to face the facts and put your worries to rest. Lucky Numbers: 3, 9, 13TAURUS APRIL 21-MAY 21Look to have an enticing conversation that opens your eyes to a different viewpoint from your own. You may be inspired to take action on a goal that’s been stagnant. Lucky Numbers: 1, 11, 16GEMINI MAY 22-JUNE 21Pull back from a burdensome friendship that demands too much of your time and energy. You need to mingle with more people who enhance your life and not drain it. Lucky Numbers: 17, 19, 25CANCER JUNE 22-JULY 22You’ll meet a new acquaintance who is more in sync with your interests and lifestyle than many others in your…2 min

National Enquirer|June 17, 2024SUDOKUHOW TO PLAYYou must fill in every empty square in the Sudoku grid. There’s no right way of going about this, but there is only ever one solution. The big grid is split into nine mini-grids. There are nine rows running left to right and nine columns running down. In every row, you must have each of the numbers 1, 2, 3, 4, 5, 6, 7, 8 and 9. These can be in any order. The same applies to columns and mini-grids: Place every number 1 through 9 in each column and in each mini-grid.GRID 1: EASYGRID 2: MEDIUMGRID 3: HARDANSWERS FOR THESE PUZZLES CAN BE FOUND ON PAGE 46…1 min

National Enquirer|June 17, 2024AnswersCROSSWORD #24 SOLUTIONANSWER: GRANDFATHERCRISS CROSS SOLUTION from page 24UNDER THE HOODCODE BREAKERS #24 SOLUTIONMOOSE ON THE LOOSEMYSTERY WORDS: NORTHERN EXPOSUREWORD SEARCH ANSWER from page 24BLACK-AND-WHITE ANIMALSSPOT THE DIFFERENCES ANSWERS from page 381. Fire alarm unit on wall is bigger2. Poster is longer3. Green chair back is bigger4. Note next to phone cord vanished5. Model plane is larger6. Globe moved into frame7. The “T” in TWA is missing left crossbar8. Handle on bar cart is tallerDOMINOES FROM PAGE 44SUDOKUGRID 1: EASYGRID 2: MEDIUMGRID 3: HARDCELEBRITY SQUEEZE 88…1 min

National Enquirer|June 17, 2024GAYLE’S BIG FAIL!FLAILING CBS newsgal Gayle King’s much ballyhooed weekly primetime talk show King Charles — on rival CNN — was abruptly axed after only a couple of months due to catastrophic ratings, and now sources say she’s willing to do anything to keep herself relevant!The 69-year-old CBS Mornings host raised eyebrows when she practically threw herself at ripped rocker Lenny Kravitz after her CNN disaster, gushing during the sit-down, “Is there love in your life? Do you have a significant other in your life? And can I beat her a** if she is? Oops, did I say that out loud?”The cringeworthy display stunned one industry insider, who scoffs, “Not a good look for the host of a morning news program. She’s doing anything to bring attention to herself — and it’s…2 min

National Enquirer|June 17, 2024NEWS FLASHES!✚ THE longest-serving flight attendant in history, Bette Nash, who flew for more than six decades, died at 88. “Bette inspired generations of flight attendants,” says an American Airlines exec. “Fly high, Bette.”✚ BEYONCÉ is being sued by a New Orleans group claiming she infringed on their copyright by using elements of their song. In her hit Break My Soul, the bootylicious one sings the lyrics “release ya wiggle,” which Da Showstoppaz say was created by them!✚ ACTRESS Jennifer Tilly and The Real Housewives of Beverly Hills have made it official! The 65-year-old Bride of Chucky star is joining the cast as a friend of housewife Sutton Stracke after appearing regularly in previous seasons.✚ ACCUSED abuser Sean Combs’ eyewear line has been dropped by America’s Best. The eyeglass retailer, which…2 min

See Also

Petals and Pearls - bedtime_at_four_am

National Enquirer|June 17, 2024BATTERED BRAD DISOWNED AGAIN!DEVASTATED dad Brad Pitt is reeling from emotional blows delivered by the beloved children he shares with former wife Angelina Jolie — and fears his ex has turned their six kids against him amid their ongoing legal battles, sources spill.The bickering duo’s 15-year-old daughter, Vivienne, recently left off her famous father’s surname from the producer credit she shares with her mom for the Broadway musical The Outsiders and simply calls herself Vivienne Jolie!The change comes less than a year after the Fight Club stud’s oldest girl, Zahara, 19, dropped Pitt from her handle during her initiation into the Alpha Kappa Alpha sorority at Spelman College!According to an insider, “They’re taking turns kicking their dad when he’s down — and Brad’s convinced Angie is brainwashing them to do it! He’s so…2 min

National Enquirer|June 17, 2024HALLMARK TV TEEN FALLS FIVE FLOORSTRAGIC talent Mamie Laverock — who stars as Rosaleen Sullivan in the Hallmark Channel’s When Calls the Heart — is on life support after falling five stories from a balcony walkway at a Vancouver hospital, according to the 19-year-old’s devastated family.Laverock’s parents, Nicole and Rob Compton, reveal their daughter experienced a “medical emergency” on May 11, but the teen’s mom managed “to get there in time to save her.” They explain after two weeks of “intensive treatment” their child was being escorted from a “secure unit” when she plunged to the ground floor and sustained severe injuries.Johannah Newmarch — who plays Laverock’s onscreen mother — says, “I love this wonderful family so much, and my heart is broken. Such a devastating time for them and all who care deeply for…1 min

National Enquirer|June 17, 2024HOLLYWOOD STRAIGHT SHUTER!DeSANTIS EYES TV FOR DeSPOTLIGHT!FLORIDA Gov. Ron DeSantis is making a shocking pivot from politics to showbiz as he eyes a spot on the FOX News primetime lineup, tipsters dish.The pol Donald Trump once branded Ron DeSanctimonious is using his guest host gig on Sean Hannity’s radio show as a springboard to the entertainment spotlight, sources squeal.“DeSantis is gunning for his own show,” spills an insider, who says the ambitious right winger may be aiming for more than just a guest spot. “Sean better watch his back — Ron’s not one to stay loyal for long!”DeSantis, 45, still has nearly three years left as the Sunshine State’s top dog, but insiders say he’s salivating for more — and whispers in the corridors of power are that even though the petulant…4 min

National Enquirer|June 17, 2024REBA IS VOICE’S LAST BEST HOPE!COUNTRY QUEEN Reba McEntire is extending her reign on The Voice even as fellow judges John Legend, Chance the Rapper and Dan + Shay are exiled in what insiders say is a last-ditch effort by producers to keep the talent competition from being silenced by dismal ratings.Though she’s only been on the show for two seasons, Reba, 69, was the champion of the show’s 25th season, having coached contestant Asher HaVon to the winner’s circle last month.“The Voice is trying to usher in a new era and Reba is leading the charge,” a TV industry source says. “She has become the linchpin of the show — it didn’t take long for her to take over!”Not only is she Nashville royalty, but the I’m a Survivor singer is a movie and…2 min

National Enquirer|June 17, 2024LITTLE BOY, 6, HAS BIG HEARTSELFLESS six-year-old Evan Croxell offered up his toys to neighborhood kids in Iowa after a terrifying twister tore through his small town and destroyed hundreds of homes!Evan made the heartwarming gesture of setting up a stand on his front lawn in Greenfield to give away his playthings after hearing about children who lost everything when severe storms ravaged the region.“One of my friends didn’t have their house,” the youngster says.The do-gooder’s mom, Kaci, reveals she and her two sons huddled in the basem*nt as tornadoes shredded trees and toppled nearby buildings!“It was just nuts,” she recalls. “You could just hear the wind and the hail, and then all of a sudden it just got real loud and real windy.”The fortunate family were among the few of the city’s nearly 2,000…2 min

National Enquirer|June 17, 2024CRISS CROSSHOW TO PLAY: All the words in the lists appear in alphabetical order and are listed according to their length. They need to be put into their correct positions in the grid, which is easier said than done! Sometimes several words will fit in the same space. This means you’ll have to think a few steps ahead and try different combinations of words until you find the ones that fit.UNDER THE HOOD4 LETTERSAUTOBELTFUSEHAULSUMPTEST5 LETTERSBLOCKRELAYTOOLSTURBOVALVE6 LETTERSENGINEFILTERINTAKESENSOR7 LETTERSBATTERY8 LETTERSCYLINDERDIPSTICKFLYWHEELFUEL RAILRADIATOR9 LETTERSHEADLIGHTHOOD LATCHSPARK PLUGWATER PUMP10 LETTERSTIMING BELTVALVE COVER11 LETTERSENGINE MOUNTINTERCOOLER12 LETTERSBRAKE BOOSTERTHROTTLE BODYANSWERS FOR THESE PUZZLES CAN BE FOUND ON PAGE 46…1 min

National Enquirer|June 17, 2024CROSSWORD #25HOW TO PLAYUnscramble the letters highlighted in the finished puzzle to spell a healthy cereal topperACROSS1 Bean counter, for short4 Snow coaster8 Academy Award13 “Get going!”17 Take up a skirt18 Unlikely to bite19 Bend in a road20 Cut words21 Branch22 Archaeological site23 Hints24 — Scotia25 Trailblazer27 John Wayne nickname28 Like apples or oranges30 Ring bearer, maybe31 Mimic32 Fly traps33 Pile up neatly36 Harbor bobber37 Parentheses, e.g.38 Silent Spring subject41 Beep42 Wyo. neighbor43 Fly like a hummingbird44 Ticket info, maybe45 Away from the bow46 Danson of CSI47 Refine, as metal49 Approximately, in dates50 Rock band instrument52 “… or —!”53 Good way to go out (2 wds.)54 Is finally over56 — canto57 Like a bug in a rug59 Fire starter62 — moss64 Portland’s home68 Grads69 Dentist’s direction71 Undertake, with “out”72 Santa —…2 min

National Enquirer|June 17, 2024NEW DIET DRUGS MAY CURB BOOZESO-CALLED miracle diet drugs like Ozempic and Wegovy, originally approved to help control high blood sugar in type 2 diabetics, have revolutionized the weight-loss industry and turned many Hollywood heavyweights into skinny stars.Now drugmaker Novo Nordisk is conducting a 28-week clinical study to see if semaglutide, the active ingredient in the drugs, can also help reduce cravings for alcohol by decreasing the amount of dopamine the brain releases after consuming booze. There have been many anecdotal reports of users saying their desire to drink diminished while taking the drugs.The new trial won’t investigate semaglutide’s effects on alcohol addiction specifically, but instead on whether it can improve liver health by reducing the risk of users’ developing fibrosis or scarring.“There is a significant unmet medical need for treating alcohol-related liver disease and…1 min

National Enquirer|June 17, 2024BIKERS BAGGED FOR BUSTING IAN’S CHOPS!COPS busted two motorcycle thugs they say attacked actor Ian Ziering on New Year’s Eve — despite video evidence that the hotheaded Beverly Hills, 90210 actor may have ignited the brawl by throwing the first punch!The LAPD booked Jacob Esteban Hernandez, 20, for felony vandalism and Angie Teresa Guizar, 40, for assault with a deadly weapon five months after the incident, which was captured on video and showed Ian was the first to put up his dukes after a slew of bikers cut off his car.The smackdown occurred after Ian, 60, jumped out of his $100,000 Mercedes on Hollywood Boulevard to assess whether the brazen pack of minibikers scratched his pricey ride.After exchanging punches with three opponents, the Sharknado star, whose daughter was cowering inside the car, fled while an…1 min

National Enquirer|June 17, 2024BACK DOOR BEAR AMBUSHES TEEN!AN ARIZONA teen is lucky to be alive after a crazed black bear burst into the cabin where he was watching TV and attacked him!Brigham Hawkins, a 15-year-old who suffers from a rare neurological disorder, was kicking back in the cabin after a day of fishing when the beast entered the place through an open door.“He didn’t realize it because the bear came in from behind. It reached over and like swiped at his face twice,” says his mom, Carol, who was in a nearby cabin. “Got him on the nose and the cheek and then went and got his forehead and the top of his head.”Brigham, whose condition makes it hard for him to move fast, cried out for help. His big brother Parker heroically answered the call!He got…2 min

National Enquirer|June 17, 2024HITLER’S YACHT SUNK OFF MIAMINAZI demon Adolf Hitler is long gone — and his prized racing yacht Ostwind is finally sleeping with the fishes off the coast of Miami!It was a long, strange trip for the 80-foot sailboat commissioned by Hitler in 1938 with intentions to race it in the next Olympics. However, the Ostwind never made the Games but was said to be used by the Nazi elite, including Hitler and his mistress Eva Braun.Following World War II, the Ostwind was seized by the Americans as war booty and used for training at the U.S. Naval Academy in downtown Annapolis, Md.The Navy sold it in the 1950s, and for two decades it passed between owners and got a reputation for being cursed as two of them died from heart attacks and a third…1 min

National Enquirer|June 17, 2024CLUELESS MEGHAN’S SKIN-CREDIBLE AFRICAN BLUNDER!SHAMELESS duch*ess Meghan is being slammed for her culture-rocking “nakedness” during her recent mini-tour of Nigeria with Prince Harry.Days after the palace renegades flew back to their $14 million Montecito mansion, they pledged to return many times to the African nation, home of Meghan’s ancestors. But sources say Nigeria’s first lady may be slow to roll out the red carpet after she took aim at the former actress’ skimpy clothing choices and her bid to be a role model for young Nigerian women!“We don’t accept nakedness in our culture,” huffs Senator Oluremi “Remi” Tinubu in urging her nation’s teenagers and young people to reject risqué Hollywood fashion trends. “This is not the Met Gala. The nakedness [for women] is everywhere while the men are well-clothed. That is not beautiful. So…2 min

National Enquirer|June 17, 2024CELEB GOLFER GETS OFF EASYPRO golf sensation Scottie Scheffler is getting a mulligan from law enforcement officials — charges against the PGA’s top-ranked player, including second-degree assault on a police officer, are being dropped!Scheffler, 27, allegedly ignored a cop’s orders after a pedestrian fatality shut down a street at Valhalla Country Club in Louisville, Ky., on the morning of the second round of the PGA Championships.As The National ENQUIRER reported, the links phenom was treated with kid gloves by authorities after being arrested and was sprung from jail with plenty of time to tee off on schedule at the major tournament.Scheffler insisted all along it was a “big misunderstanding,” claiming he was confused about where to go and didn’t realize the yellow vest–clad dude directing traffic was a police officer.Jefferson County attorney Mike O’Connell…1 min

National Enquirer|June 17, 2024SURVIVOR COUPLE IN UGLY DIVORCE!THEY survived the show but not marriage! Survivor: China contestants Jaime Dugan and Erik Huffman are divorcing 17 years after meeting on the reality show, falling in love and getting hitched!Last month, Jaime filed for divorce, citing marital infidelity, domestic violence, substance abuse and attempted sexual assault in the bombshell court papers.The accusations brand Erik as a boozer who flew into wild rages and cheated on her — and she also implies he was a switch-hitter! In the docs, Jaime, 38, says she found flirty messages from guys on his phone, and when confronted, Erik, 43, “began screaming, ‘How dare you accuse me of being gay, you stupid b*tch?’”She also claims when Erik thought she was kissing a man at the restaurant where she worked, he “punched a hole into…1 min

National Enquirer|June 17, 2024BRITNEY’S BRO HELPS HEAL FAMILY RIFTTROUBLED pop tart Britney Spears’ brother, Bryan, is helping to thaw the arctic relationship between the singer and her iced-out family!Bryan, 47, has escaped becoming a target of Brit’s fury and was her closest confidant after her split from ex-husband Sam Asghari in 2023.In a recent Instagram post, the siblings were seen laughing together at a spa in Las Vegas less than a week after the Toxic singer, 42, announced she is considering forgiving her parents!“Bryan is acting like Henry Kissinger and trying to bring Britney and the rest of the family together,” an insider snitches. “He has been working overtime to get Brit to believe her family only wants to be there for her and is not the enemy.”The family’s bonds crumbled when their dad, Jamie, 71, placed Britney…1 min

National Enquirer|June 17, 2024GLORY DAYS OVER FOR SPRINGSTEEN!BORN to Run dynamo Bruce Springsteen is finally slowing down after more than 50 years of relentless touring — and sources say mounting health problems now threaten to silence one of rock ’n’ roll’s most powerful voices!Just months after the Boss was forced to cancel a slew of U.S. concert dates due to a crippling peptic ulcer, the 74-year-old rocker axed a string of European shows in late May and early June for what his management called “vocal issues.”In his storied career, Bruce has played more than 3,500 concerts, marathon affairs lasting between three and four hours. But now fans across the globe fear the canceled shows may signal the end of his touring glory days!“Bruce is America’s biggest musical road warrior,” declares an insider. “He always told his pals…2 min

National Enquirer|June 17, 2024PENTAGON SNUBBING VETS EXPOSED TO A-BOMB TESTS!COLDHEARTED Pentagon officials are stonewalling pleas for help from Air Force veterans left sick from serving at a top secret Nevada base where nuclear weapons were tested for decades, sources say.Dave Crete, 59, and Pomp Braswell, 57, allege they haven’t been able to claim Department of Defense assistance because the base at which they served, Tonopah Test Range, is so secret the Pentagon refuses to acknowledge that they were ever there!“It pisses me off,” fumes Crete, a former Air Force security officer. “They say their aircraft was there but not us, so the aircraft flew itself, guarded itself, parked itself and repaired itself?“Because we’re not acknowledged as line of duty, we have people dying with kids with zero benefits for those kids or that widow.”The two vets say they —…3 min

National Enquirer|June 17, 2024FACEBOOK UNFRIENDS DIVERSITY EXEC CROOK!FACEBOOK’s former diversity program manager Barbara Furlow-Smiles got shipped to the slammer for five years after scamming the social media giant out of nearly $5 million through bogus business deals, lawmen say.According to the feds, Furlow-Smiles, 38, funded her lavish lifestyle in California, Georgia and Oregon by concocting fake contracts and invoices — and soliciting cash kickbacks!The ousted exec was supposed to bolster the tech company’s efforts toward equity and inclusion during her tenure from January 2017 to September 2021 — but U.S. Attorney Ryan K. Buchanan charges she “shamelessly violated her position of trust!”The big spender had access to corporate credit cards and the ability to approve submitted bills. A federal complaint reveals she “caused Facebook to pay numerous individuals” — including her friends and relatives —“for goods and…1 min

National Enquirer|June 17, 2024HADDISH SLAMS LOVE-RAT EX!TOUGH cookie Tiffany Haddish has bounced back from getting kicked to the curb by rapper Common. But the funnygal is still smarting over watching him move on with her pal Jennifer Hudson — and fears the talk show host is on an inevitable road to heartbreak with the commitment-shy cad, sources dish.An insider squeals, “Tiffany adores Jennifer — and she’s not about to make her feel bad for dating her ex. But she considers Common a heel who is going to deal Jennifer some hurt somewhere down the line!”The Girls Trip cutup, 44, fell for the Grammy winner, 52, after they co-starred in 2019’s The Kitchen — but their fling screeched to a halt by August 2021.“It wasn’t mutual,” confides Tiffany, who says her ex determined their relationship had “run…2 min

National Enquirer|June 17, 2024SOAP STAR DIES A HERO!SOAP actor Johnny Wactor died a real-life hero—sacrificing himself to protect a female co-worker after confronting killer criminals who were trying to swipe his car’s catalytic converter!Johnny’s grieving brother Grant Wactor, 29, tells The National ENQUIRER the 37-year-old former General Hospital star was mercilessly murdered after leaving the rooftop bar where he worked as a bartender in downtown Los Angeles.“He was escorting his female co-worker to the parking lot because it was 3 o’clock in the morning and they’d parked a few blocks away,” Grant explains. “Johnny had that old-school Southern instinct, you walk a woman to her car.”As they approached the vehicle, he saw what looked like three people trying to tow it. When he asked them what was going on, one of the masked men pushed a gun…2 min